PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A01772.1.p
Common NameEUGRSUZ_A01772, LOC104440232
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 361aa    MW: 40140.3 Da    PI: 6.3876
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A01772.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12e-181461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT+eEd++l+++++ +G+g+W+t ++  g+ R++k+c++rw +yl
  Eucgr.A01772.1.p 14 KGPWTPEEDLKLINYIQAHGPGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                      79********************************************97 PP

2Myb_DNA-binding54.52.7e-1767111147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
  Eucgr.A01772.1.p  67 RGRFSFEEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                       89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.3E-27564IPR009057Homeodomain-like
PROSITE profilePS5129418.817961IPR017930Myb domain
SuperFamilySSF466894.49E-3111108IPR009057Homeodomain-like
SMARTSM007172.8E-141363IPR001005SANT/Myb domain
PfamPF002491.3E-161461IPR001005SANT/Myb domain
CDDcd001674.06E-121661No hitNo description
PROSITE profilePS5129425.25562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2665116IPR009057Homeodomain-like
SMARTSM007171.8E-1666114IPR001005SANT/Myb domain
PfamPF002491.2E-1567111IPR001005SANT/Myb domain
CDDcd001672.26E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MGRAPCCDKN GLKKGPWTPE EDLKLINYIQ AHGPGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRNG  120
IDPVTHAPRL DLLDLSSLLS SSLCNPPLIN MANLLKTQAL LNPELLRLAS TILSLKNENP  180
DLLSQNNLQE NQISDPNAFP LSHSNQFQVQ AQSQGQQVPA CTTSTLPCGP LVDQAQLGQA  240
NVGDFPSNLP SNFSCSNTGQ IIVPPMESQD LVSQPHYIQC NSSPAMPAPL EKLCHFQPNN  300
GDDQNFRFDS IMSTPLSSST PLNSSSTFVN SSSEEERESY CSSFFKFELP ESLDINDFMC  360
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C3e-31121162105C-Myb DNA-Binding Domain
1msf_C3e-31121162105C-Myb DNA-Binding Domain
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A01772.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010051495.10.0PREDICTED: transcription factor MYB39
TrEMBLA0A059DGZ60.0A0A059DGZ6_EUCGR; Uncharacterized protein
STRINGPOPTR_0019s14070.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.12e-90MYB-like 102